PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA18915
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family S1Fa-like
Protein Properties Length: 84aa    MW: 9195.87 Da    PI: 10.5229
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA18915genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA133.26.7e-421983670
                       S1FA  6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                                 ++G+nPGlivllvvgglll+fl+gny+ly+yaqk++PPrkkkPvskkk+k+e+lkqGv++PGe
  Tp57577_TGAC_v2_mRNA18915 19 NASQGFNPGLIVLLVVGGLLLTFLIGNYALYIYAQKTIPPRKKKPVSKKKMKKERLKQGVSAPGE 83
                               4569************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190136.0E-52083No hitNo description
PfamPF046892.6E-402083IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MADDFDFSDK IPPSFDRVNA SQGFNPGLIV LLVVGGLLLT FLIGNYALYI YAQKTIPPRK  60
KKPVSKKKMK KERLKQGVSA PGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015970026.18e-29PREDICTED: DNA-binding protein S1FA-like
RefseqXP_016207936.18e-29PREDICTED: DNA-binding protein S1FA-like
SwissprotQ7XLX61e-15S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA0A0A0KEM33e-27A0A0A0KEM3_CUCSA; DNA-binding protein S1FA
STRINGPOPTR_0016s08890.11e-23(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09735.18e-07S1FA-like DNA-binding protein